PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10003277
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 248aa    MW: 27555.9 Da    PI: 5.6512
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10003277genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-17550348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd ll ++++q+G g W++++   g++R++k+c++rw++yl
      Lus10003277  5 AWTEEEDHLLRKCIEQYGEGKWHRVPLLAGLNRCRKSCRLRWLNYL 50
                     7*******************************************97 PP

2Myb_DNA-binding25.23.9e-085796247
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     g++  eE el+++++k      W++Ia ++  gRt++++k++w+ +
      Lus10003277 57 GSFGDEEVELIIKLHK----L-WSLIAGRLS-GRTANDVKNYWNCH 96
                     5556666666666554....5.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.591154IPR017930Myb domain
SMARTSM007175.7E-13252IPR001005SANT/Myb domain
PfamPF002491.5E-15550IPR001005SANT/Myb domain
SuperFamilySSF466891.68E-21593IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-21557IPR009057Homeodomain-like
CDDcd001675.09E-10550No hitNo description
SMARTSM007179.9E-65599IPR001005SANT/Myb domain
PROSITE profilePS5129410.51555101IPR017930Myb domain
PfamPF002499.0E-65694IPR001005SANT/Myb domain
CDDcd001671.33E-65897No hitNo description
Gene3DG3DSA:1.10.10.609.9E-1758101IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGGVAWTEEE DHLLRKCIEQ YGEGKWHRVP LLAGLNRCRK SCRLRWLNYL RPNIRRGSFG  60
DEEVELIIKL HKLWSLIAGR LSGRTANDVK NYWNCHLSKR LTPATSQDQA AAADDQDVTK  120
LQLTSSVVAA ATPTEIMRSY PSNNIINYGQ QGIILQEEYS CTTSTARATP PPPQLPLPPV  180
LFAEDGSSSS SNWVLNGGIK EHEGPAGFPG GGGEEMIGME HQFRFESCSS AKWDWDDLIG  240
DLDRWGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A9e-1661145116MYB3
3zqc_D9e-1661145116MYB3
3zqc_G9e-1661145116MYB3
3zqc_J9e-1661145116MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007030250.11e-67Myb domain protein 113, putative
SwissprotQ9FNV94e-48MY113_ARATH; Transcription factor MYB113
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-48myb domain protein 113